Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 60454::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe General Bacterial Porin (GBP-1) Family 1
Protein descriptionOuter membrane protein 1A/OmpK35 porin
Gene nameOrderedLocusNames=EAE_15245
SpeciesKlebsiella aerogenes (strain ATCC 13048 / DSM 30053 / JCM 1235 / KCTC 2190/ NBRC 13534 / NCIMB 10102 / NCTC 10006) (Enterobacter aerogenes)
NCBI taxonomy1028307
Protein sequence

MMKRNILAVVIPALLVAGAANAAEIYNKNGNKLDFYGKMVGEHVWTTNGDTSSDDTTYAR
IGLKGETQINDQLIGYGQWEYNMDASNVEGSQTTKTRLAFAGLKAGEYGSFDYGRNYGAI
YDVESATDMLVEWGGDGWNYTDNFMTGRTNGVATYRNSDFFGLVDGLSFALQYQGKNDHD
RSIRKQNGDGFSTAATYAFDNGIALSAGYANSNRSVDQKRDGNGDKAEAWATSAKYDANN
IYAAVMYSQTYNMTPEEDDHFAGKTQNFEAVVQYQFDFGLRPSLGYVQTKGKNLQARGGF
GGGDADLVKYVELGTWYYFNKNMNVYAAYKFNQLDDNAYTRAAGVATDDQAAVGIVYQF
Sequence length359 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotA0A0H3FYJ7
PDB5O78
PfamPF00267
EMBLCP002824
InterProIPR033900 | IPR023614 | IPR001897 | IPR001702
PRINTSPR00183 | PR00182
Signal peptide annotation
Amino acids1-22
Sequence

MMKRNILAVVIPALLVAGAANA
Annotation sourceExperimentally verified
TM annotation
# beta strands16
Protein topology

IIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOM
MMMMMIIIIIIIIIMMMMMMMMMMMMMOMMMMMMMMMMMMMMMMMIIMMMMMMMMMMOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMMIIIIMMMMMMMOOOOOOOOOOO
OOOOOOOOOOOMMMMMMMIIMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIII
MMMMMMMMOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIMMMMMMMMOOOOOOOOOOOOO
OOOOOOOOOOMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOMMMMMMMMI
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen