Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 43944::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Outer Membrane Porin (OprD) Family
Protein descriptionOprD family porin
Gene nameORFNames=ABUW_2771, DLI69_08790, FDO31_04100, GFL19_06585
SpeciesAcinetobacter baumannii
NCBI taxonomy470
Protein sequence

MKKTPWWVGVCLCPLFSQVVHAEFIADSKAELTLRNFYFDRDYKKDPYPYTAARDWAQGL
IFKGQSGYTEGTVGFGVDVLAMAGFNLMGSRADDYARSGLLPVNTDNSRDDYYGKIGITG
KAKFRKNELFVGDLVPQLPTIFSSPARLFPQTYRGIRFVSNEIPNLQLEGFYVDEVRQRD
SIRYTDVGTDNINHRFNKAATTDSFYTLGGSYQLKDYRLRAYHAELKDIYQQQFLGFNGK
QPLNDQLNFLSDVRFFNSEETGSKKIGEVDNRHISGLFGLNYQNHTVSLGYMQSFGSTGL
PFLSGTESPVVLDFMSSDYSNKDEKVYSIRYEYDFKNARIGDVSLNGLRFMTRYAKGEDI
DLLQYGDQRFKEDSLEFDLGYKIPEGKLKGLGMRARFSHYRNDMPTNMTFHSANETRLNV
DYTFKF
Sequence length426 AA
FragmentNo
pHHM coverage99.75 %
Cross-references
UniprotA0A0D5YKR4
PDB5DL7
PfamPF03573
EMBLCP008706 | VJZY01000005 | WIGZ01000005 | CP045541
InterProIPR005318 | IPR023614
Signal peptide annotation
Amino acids1-22
Sequence

MKKTPWWVGVCLCPLFSQVVHA
Annotation sourceExperimentally verified
TM annotation
# beta strands18
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMOOOOOOOOOOOOOOOOMMMMM
MMMMMMIIIIIIIIMMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMM
MMMIIIMMMMMMMMOOOOOOOOOOOOOOOOOMMMMMMMMMIIIIIMMMMMMMMOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIMMMMMMMOOOOOOOMMMMMMMMI
IIIIIIIIMMMMMMMMMOOOOOOOOOOOOOOOMMMMMMMMIIIIMMMMMMMMMOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIIIIIIIIIIMMMMMMMMMOOOO
OOOOOOOOOOOOOMMMMMMMMMIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOMMMMM
MMMMII
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen